Last updated: August 2026
Global rank: Worldwide · 2026-08
#258,749
AI visibility: Grade D
59
SEO health: Latest audit
0
Visits
13
per month, estimated
Keywords
17
ranking in Google
Organic share
100%
13 organic visits
LLMS.txt
Published
71 lines AI engines can read
You're seeing the free preview of azan.ru
azan.ru Web Traffic Statistics
Key findings
- Azan (Software & Internet) is ranked #258,749 worldwide in our August 2026 domain ranking, down 970 places from #257,779 in July 2026.
- It is estimated to receive about 13 visits a month from search, 100% of it organic, across 17 ranking keywords.
- Its AI visibility score is 59 out of 100 (grade D), with a published llms.txt of 71 lines.
- Its last technical audit scored 0/100, with "Implement Title and Meta Description" the highest-priority fix.
| Month | Rank | Move |
|---|---|---|
| August 2026 | #258,749 | ▼ 970 |
| July 2026 | #257,779 | ▲ 80,731 |
| June 2026 | #338,510 | — |
| May 2026 | #338,510 | ▼ 30,791 |
| April 2026 | #307,719 | ▲ 40,370 |
| March 2026 | #348,089 | ▲ 18,808 |
| February 2026 | #366,897 | — |
What this company does
Azan provides accurate prayer times and a growing set of Islamic tools that help Muslims stay connected to their faith. The platform focuses on reliable timings based on location, along with dua collections, Islamic calendar dates, and simple community features. Users can quickly check prayer schedules, read supplications, and find upcoming events without needing multiple apps. The service is designed for both indivi…
Our read on the site
The overall SEO health of the website https://azan.ru is critically poor, with missing essential on-page elements such as title, meta description, and headings. Additionally, several technical issues such as the absence of a viewport meta tag, robots.txt, and sitemap.xml further hinder its search engine visibility.
azan.ru Traffic and Visitor Engagement
Search engines send azan.ru an estimated 13 visits a month. Effectively all of it is organic — about 13 visits from unpaid results. Spread across 17 ranking keywords, that averages roughly 0.8 organic visits per keyword.
Monthly visits
13
Latest estimate
Change
No monthly history yet
It starts building from the first scan
Organic visits
13
100% of all traffic
Paid visits
0
No paid search detected
Organic vs paid
100%
0%
We don't hold a month-by-month history for this domain yet.
The traffic dashboard builds one from the first scan onwards.
azan.ru AI Visibility
azan.ru scores 59 out of 100 on our AI visibility scale, grade D. It takes full marks for LLMS.txt. The biggest gap is SEO health, at 0 of 20 points (0/100), worth 20 points if closed. It also loses points on Crawlability (0/10), Company profile (19/25) and Structured data (0/5).
Grade D
Scored from this domain's own data — llms.txt, profile completeness, technical health, crawlability and structured data.
Present
6/8 core fields
0/100
robots ✗ · sitemap ✗
Not detected
Fix these first
- → Complete your company profile so AI answers about you stay accurate.
- → Add robots.txt and sitemap.xml so AI crawlers can read you.
azan.ru LLMS.txt
The llms.txt on azan.ru runs to 71 lines (2,731 characters) across 12 sections, last generated in May 2026. It introduces the site as "Azan - Islamic Prayer Times & Resources". It tells AI engines the business works in Islamic Resources, Prayer Tools and Community Information. It describes 3 products, with prices such as Prayer Times at Free, Dua Collection at Free and Islamic Calendar at Free. Services it lists include Event Listings and Educational Articles. The audience it names is Muslim community, aged All ages (Global). Technologies it mentions include HTTPS. The keywords it claims start with "Islamic prayer times", "Dua and supplications", "Islamic calendar" and "Community events".
Status
Published
AI engines can read it
Lines
71
In the file
Size
2.7K
Characters
Sections
12
Updated May 16, 2026
What the file says
# Azan - Islamic Prayer Times & Resources ## About Azan delivers accurate prayer times and a focused collection of Islamic resources through a simple web platform. The service helps users stay on top of daily prayers, read authentic duas, and follow the Islamic calendar without extra downloads. Content includes beginner guides, articles on Islamic teachings, and listings for community events. The site is built for quick access on any device and avoids unnecessary features. Azan serves both practicing Muslims and those exploring the faith for the first time. All core tools remain free and ad-light. The project is maintained by a small team that prioritizes data accuracy and ease of use. Prayer calculations follow established methods and adjust for local regions. Regular updates keep event listings and articles current. The platform continues to grow through organic search traffic around prayer times and Islamic topics. **Areas of Work:** Islamic Resources, Prayer Tools, Community Information ## Things to Remember - **Website:** https://azan.ru - **Address:** - **Contact:** - **Phone:** - **Hours:** - **Timezone:** - **Currency:** - **Company Type:** Private - **Employees:** 1-10 - **Revenue:** Not Disclosed - **Hiring Status:** Not currently hiring ## Products - **Prayer Times** (Free): Location-based daily prayer schedules - **Dua Collection** (Free): Curated supplica
Sections in the file
Areas of work
Keywords it claims
Technologies
Products it tells AI about
- Prayer TimesFree
- Dua CollectionFree
- Islamic CalendarFree
Services it tells AI about
- Event ListingsFree
- Educational ArticlesFree
Competitors it names
Audience it targets
Muslim community · All ages · Global
Company type
Private
azan.ru Organic Keywords
Google lists azan.ru for about 17 keywords, which together bring an estimated 13 organic visits a month.
Ranking keywords
17
Found in Google for this domain
Visits they bring
13
Estimated organic visits a month
Top ranking keywords
No ranked-keyword data cached for this domain yet.
Ranked Keywords pulls the full list on its first run.
What it ranks for
azan.ru SEO Audit
The latest technical audit of azan.ru scored 0 out of 100 overall. The audit makes 20 recommendations in all, and 4 of the 4 listed first are rated high priority or critical.
Overall
SEO
Performance
Accessibility
Fix these first
- CriticalImplement Title and Meta Description
- HighAdd H1 and H2 Tags
- HighCreate a Sitemap.xml
- HighAdd Robots.txt File
16 more recommendations, with the exact changes and the pages they apply to, are in the full report.
azan.ru Competitors and Alternatives
Azan's company profile names https://islamsa.com, https://islamicfinder.org, https://prayer-times.com and https://muslimpro.com as competitors. Its own llms.txt adds https://islamicity.com and https://quran.com. Outside its market, the domains ranked closest to it in our worldwide ranking are ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click, agelessrx.com, boulderweekly.com and stpsl.net.
azan.ru Company Profile
Azan provides accurate prayer times and a growing set of Islamic tools that help Muslims stay connected to their faith. The platform focuses on reliable timings based on location, along with dua collections, Islamic calendar dates, and simple community features. Users can quickly check prayer schedules, read supplications, and find upcoming events without needing multiple apps. The service is designed for both indivi…
Azan was founded in 2018, about 8 years ago. Its workforce is listed as between 1 and 10 employees. Its profile files it under Software & Internet, with further tags for Education & Training, Islamic Resources and Prayer Times. Total funding on record is Bootstrapped. Its tagline reads: "Prayer times and Islamic resources for everyday life".
- Sector
- Software & Internet
- Founded
- 2018
- Employees
- 1-10
- Revenue
- Not Disclosed
- Funding
- Bootstrapped
azan.ru Traffic by Country
Which markets this brand actually serves, and where the web links to it from.
Top customer markets
AI estimate · live webWe only measure visitor geography for domains whose analytics are connected to us. For everyone else this is read live from the web and shown as an estimate — never mixed in with the measured numbers.
No market breakdown available for this brand.
Where its backlinks come from
Measured. The country each linking site is hosted in — a real signal of which regions know this brand.
No backlink sample for this domain yet.
Backlink Analytics collects one on its first run.
azan.ru Backlink Analytics
Who vouches for this domain. Strong, varied links are still the clearest signal of authority — to search engines and to AI engines that cite sources.
We haven't run a backlink crawl for azan.ru yet, so there are no link counts to show. Backlink Analytics builds the profile on its first run and it appears here after that.
—
links on file
Companies ranked next to azan.ru
Neighbours of #258,749 in our worldwide ranking — each with its own report.
Wait — let's zoom out.
You are looking at one domain. azan.ru competes in a market, and the same numbers exist for everyone in it — including the sites AI engines recommend instead of yours. Amrut.ai reads all of them, so you can see who is winning, why, and what to change first.
Everything above, for your own domainand the plan to fix it
Run the free scan on your site and get its AI visibility score, its gaps, and the exact next steps.
Look up another company
A brand name or a domain — the whole overview loads in seconds.